Lineage for d1k1xa1 (1k1x A:311-384)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081953Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1082010Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) (S)
  5. 1082063Family a.8.3.2: 4-alpha-glucanotransferase, domain 2 [89013] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
  6. 1082064Protein 4-alpha-glucanotransferase, domain 2 [89014] (1 species)
  7. 1082065Species Thermococcus litoralis [TaxId:2265] [89015] (3 PDB entries)
  8. 1082066Domain d1k1xa1: 1k1x A:311-384 [84279]
    Other proteins in same PDB: d1k1xa2, d1k1xa3, d1k1xb2, d1k1xb3
    complexed with ca, trs

Details for d1k1xa1

PDB Entry: 1k1x (more details), 2.4 Å

PDB Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1xa1 a.8.3.2 (A:311-384) 4-alpha-glucanotransferase, domain 2 {Thermococcus litoralis [TaxId: 2265]}
giwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlr
rtvweniikaqryl

SCOPe Domain Coordinates for d1k1xa1:

Click to download the PDB-style file with coordinates for d1k1xa1.
(The format of our PDB-style files is described here.)

Timeline for d1k1xa1: