Lineage for d1k1wa3 (1k1w A:4-310)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097583Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2097647Family c.6.2.2: 4-alpha-glucanotransferase, N-terminal domain [89554] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
    automatically mapped to Pfam PF03065
  6. 2097648Protein 4-alpha-glucanotransferase, N-terminal domain [89555] (1 species)
  7. 2097649Species Thermococcus litoralis [TaxId:2265] [89556] (3 PDB entries)
  8. 2097654Domain d1k1wa3: 1k1w A:4-310 [84278]
    Other proteins in same PDB: d1k1wa1, d1k1wa2
    complexed with ca, glc, so4

Details for d1k1wa3

PDB Entry: 1k1w (more details), 2.8 Å

PDB Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1wa3:

Sequence, based on SEQRES records: (download)

>d1k1wa3 c.6.2.2 (A:4-310) 4-alpha-glucanotransferase, N-terminal domain {Thermococcus litoralis [TaxId: 2265]}
infifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieenkp
dyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwlte
rvwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpideklry
lipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffdaits
nekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegkfek
yrvfvrg

Sequence, based on observed residues (ATOM records): (download)

>d1k1wa3 c.6.2.2 (A:4-310) 4-alpha-glucanotransferase, N-terminal domain {Thermococcus litoralis [TaxId: 2265]}
infifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieenkp
dyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwlte
rvwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpideklry
lipfrpvkktieyleslskvavfhddgekfgvwpgtywlreffdaitekinlmtyseyls
kftprglvylpiasyfemsewslpakqaklfvefveqlkeegkfekyrvfvrg

SCOPe Domain Coordinates for d1k1wa3:

Click to download the PDB-style file with coordinates for d1k1wa3.
(The format of our PDB-style files is described here.)

Timeline for d1k1wa3: