Lineage for d1k1wa1 (1k1w A:311-384)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697147Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. 2697211Family a.8.3.2: 4-alpha-glucanotransferase, domain 2 [89013] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
    automatically mapped to Pfam PF09094
  6. 2697212Protein 4-alpha-glucanotransferase, domain 2 [89014] (1 species)
  7. 2697213Species Thermococcus litoralis [TaxId:2265] [89015] (3 PDB entries)
  8. 2697218Domain d1k1wa1: 1k1w A:311-384 [84276]
    Other proteins in same PDB: d1k1wa2, d1k1wa3
    complexed with ca, glc, so4

Details for d1k1wa1

PDB Entry: 1k1w (more details), 2.8 Å

PDB Description: crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1wa1 a.8.3.2 (A:311-384) 4-alpha-glucanotransferase, domain 2 {Thermococcus litoralis [TaxId: 2265]}
giwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlr
rtvweniikaqryl

SCOPe Domain Coordinates for d1k1wa1:

Click to download the PDB-style file with coordinates for d1k1wa1.
(The format of our PDB-style files is described here.)

Timeline for d1k1wa1: