| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) ![]() |
| Family c.47.1.9: Disulfide bond isomerase, DsbC, C-terminal domain [52898] (1 protein) elaborated common fold |
| Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (1 species) |
| Species Escherichia coli [TaxId:562] [52900] (4 PDB entries) |
| Domain d1jzob1: 1jzo B:61-216 [84269] Other proteins in same PDB: d1jzoa2, d1jzob2 mutant |
PDB Entry: 1jzo (more details), 1.92 Å
SCOP Domain Sequences for d1jzob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzob1 c.47.1.9 (B:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli}
nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry
lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
gtpavvlsngtlvpgyqppkemkefldehqkmtsgk
Timeline for d1jzob1: