SCOP 1.65: Domain d1jzob1: 1jzo B:61-216

Lineage for d1jzob1 (1jzo B:61-216)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.9: Disulfide bond isomerase, DsbC, C-terminal domain [52898] (1 protein)
   elaborated common fold

6. Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (1 species)

7. Species Escherichia coli [TaxId:562] [52900] (4 PDB entries)

8. Domain d1jzob1: 1jzo B:61-216 [84269]
   Other proteins in same PDB: d1jzoa2, d1jzob2
   mutant

Details for d1jzob1

PDB Entry: 1jzo, 1.92 Å

PDB Description: dsbc c101s

SCOP Domain Sequences for d1jzob1:

Sequence; same for both SEQRES and ATOM records:

>d1jzob1 c.47.1.9 (B:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli}
nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry
lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
gtpavvlsngtlvpgyqppkemkefldehqkmtsgk

Timeline for d1jzob1:

• d1jzob1 is new in SCOP 1.65
  
• d1jzob1 appears in SCOP 1.67
  
• d1jzob1 appears in the current release, SCOPe 2.08