SCOPe 2.06: Domain d1jzoa1: 1jzo A:61-215

Lineage for d1jzoa1 (1jzo A:61-215)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
   elaborated common fold

6. Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (2 species)

7. Species Escherichia coli [TaxId:562] [52900] (5 PDB entries)
   Uniprot P21892

8. Domain d1jzoa1: 1jzo A:61-215 [84267]
   Other proteins in same PDB: d1jzoa2, d1jzob2

Details for d1jzoa1

PDB Entry: 1jzo, 1.92 Å

PDB Description: dsbc c101s

PDB Compounds: (A:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d1jzoa1:

Sequence; same for both SEQRES and ATOM records:

>d1jzoa1 c.47.1.9 (A:61-215) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}
nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry
lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
gtpavvlsngtlvpgyqppkemkefldehqkmtsg

Timeline for d1jzoa1:

• d1jzoa1 first appeared in SCOP 1.65
  
• d1jzoa1 appears in SCOPe 2.05
  
• d1jzoa1 appears in SCOPe 2.07
  
• d1jzoa1 appears in the current release, SCOPe 2.08