Lineage for d1jznb_ (1jzn B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336808Protein Galactose-specific C-type lectin [90061] (1 species)
  7. 336809Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)
  8. 336811Domain d1jznb_: 1jzn B: [84263]

Details for d1jznb_

PDB Entry: 1jzn (more details), 2.2 Å

PDB Description: crystal structure of a galactose-specific c-type lectin

SCOP Domain Sequences for d1jznb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jznb_ d.169.1.1 (B:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox)}
nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
qvceskdaflcqckf

SCOP Domain Coordinates for d1jznb_:

Click to download the PDB-style file with coordinates for d1jznb_.
(The format of our PDB-style files is described here.)

Timeline for d1jznb_: