SCOPe 2.07: Domain d1jzdc_: 1jzd C:

Lineage for d1jzdc_ (1jzd C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)

7. Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)

8. Domain d1jzdc_: 1jzd C: [84261]
   Other proteins in same PDB: d1jzda1, d1jzda2, d1jzda3, d1jzdb1, d1jzdb2
   complexed with DsbC
   disulfide-linked complex with the C-terminal domain

Details for d1jzdc_

PDB Entry: 1jzd, 2.3 Å

PDB Description: dsbc-dsbdalpha complex

PDB Compounds: (C:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1jzdc_:

Sequence; same for both SEQRES and ATOM records:

>d1jzdc_ b.1.17.1 (C:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
defygkseiyrdrltlpvtinqasagatltvtyqgaadagfcyppetktvplsevvan

Timeline for d1jzdc_:

• d1jzdc_ first appeared in SCOP 1.65
  
• d1jzdc_ appears in SCOPe 2.06
  
• d1jzdc_ appears in the current release, SCOPe 2.08