Lineage for d1jzdc_ (1jzd C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765029Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2765030Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)
  6. 2765031Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)
  7. 2765032Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)
  8. 2765036Domain d1jzdc_: 1jzd C: [84261]
    Other proteins in same PDB: d1jzda1, d1jzda2, d1jzda3, d1jzdb1, d1jzdb2
    complexed with DsbC
    disulfide-linked complex with the C-terminal domain

Details for d1jzdc_

PDB Entry: 1jzd (more details), 2.3 Å

PDB Description: dsbc-dsbdalpha complex
PDB Compounds: (C:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1jzdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzdc_ b.1.17.1 (C:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
defygkseiyrdrltlpvtinqasagatltvtyqgaadagfcyppetktvplsevvan

SCOPe Domain Coordinates for d1jzdc_:

Click to download the PDB-style file with coordinates for d1jzdc_.
(The format of our PDB-style files is described here.)

Timeline for d1jzdc_: