Lineage for d1jyda_ (1jyd A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2062523Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2062918Protein Retinol binding protein [50816] (5 species)
  7. 2062936Species Human (Homo sapiens) [TaxId:9606] [50819] (9 PDB entries)
  8. 2062939Domain d1jyda_: 1jyd A: [84255]
    complexed with gol

Details for d1jyda_

PDB Entry: 1jyd (more details), 1.7 Å

PDB Description: Crystal Structure of Recombinant Human Serum Retinol-Binding Protein at 1.7 A Resolution
PDB Compounds: (A:) plasma retinol-binding protein

SCOPe Domain Sequences for d1jyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyda_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngyc

SCOPe Domain Coordinates for d1jyda_:

Click to download the PDB-style file with coordinates for d1jyda_.
(The format of our PDB-style files is described here.)

Timeline for d1jyda_: