SCOPe 2.08: Domain d1jwud2: 1jwu D:122-239

Lineage for d1jwud2 (1jwu D:122-239)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
   Uniprot P23313

8. Domain d1jwud2: 1jwu D:122-239 [84253]
   Other proteins in same PDB: d1jwua1, d1jwua2, d1jwub1, d1jwub2, d1jwud1

Details for d1jwud2

PDB Entry: 1jwu, 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1jwud2:

Sequence; same for both SEQRES and ATOM records:

>d1jwud2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1jwud2:

• d1jwud2 first appeared in SCOP 1.65
  
• d1jwud2 appears in SCOPe 2.07