SCOPe 2.06: Domain d1jwud1: 1jwu D:1-121

Lineage for d1jwud1 (1jwu D:1-121)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
   Uniprot P23313

8. Domain d1jwud1: 1jwu D:1-121 [84252]
   Other proteins in same PDB: d1jwua1, d1jwua2, d1jwub1, d1jwub2, d1jwud2

Details for d1jwud1

PDB Entry: 1jwu, 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1jwud1:

Sequence, based on SEQRES records:

>d1jwud1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records):

>d1jwud1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

Timeline for d1jwud1:

• d1jwud1 first appeared in SCOP 1.65
  
• d1jwud1 appears in SCOPe 2.05
  
• d1jwud1 appears in SCOPe 2.07
  
• d1jwud1 appears in the current release, SCOPe 2.08