Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries) |
Domain d1jwua2: 1jwu A:3-81 [84249] Other proteins in same PDB: d1jwua1, d1jwub1, d1jwub2, d1jwud1, d1jwud2 |
PDB Entry: 1jwu (more details), 2.3 Å
SCOPe Domain Sequences for d1jwua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwua2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1jwua2:
View in 3D Domains from other chains: (mouse over for more information) d1jwub1, d1jwub2, d1jwud1, d1jwud2 |