Lineage for d1jwua1 (1jwu A:82-182)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760288Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 1760299Domain d1jwua1: 1jwu A:82-182 [84248]
    Other proteins in same PDB: d1jwua2, d1jwub1, d1jwub2, d1jwud1, d1jwud2

Details for d1jwua1

PDB Entry: 1jwu (more details), 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1jwua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwua1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOPe Domain Coordinates for d1jwua1:

Click to download the PDB-style file with coordinates for d1jwua1.
(The format of our PDB-style files is described here.)

Timeline for d1jwua1: