Lineage for d1jwsd1 (1jws D:1-121)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1788382Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1788447Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 1788448Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 1788470Domain d1jwsd1: 1jws D:1-121 [84246]
    Other proteins in same PDB: d1jwsa1, d1jwsa2, d1jwsb1, d1jwsb2, d1jwsd2

Details for d1jwsd1

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1jwsd1:

Sequence, based on SEQRES records: (download)

>d1jwsd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdgmfnwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1jwsd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdgmfnwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOPe Domain Coordinates for d1jwsd1:

Click to download the PDB-style file with coordinates for d1jwsd1.
(The format of our PDB-style files is described here.)

Timeline for d1jwsd1: