Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (6 PDB entries) |
Domain d1jwsa2: 1jws A:3-81 [84243] Other proteins in same PDB: d1jwsa1, d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2 mutant |
PDB Entry: 1jws (more details), 2.6 Å
SCOP Domain Sequences for d1jwsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwsa2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1jwsa2:
View in 3D Domains from other chains: (mouse over for more information) d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2 |