Lineage for d1jwmb2 (1jwm B:1-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183369Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2183411Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 2183422Domain d1jwmb2: 1jwm B:1-92 [84239]
    Other proteins in same PDB: d1jwma1, d1jwma2, d1jwmb1, d1jwmd1, d1jwmd2

Details for d1jwmb2

PDB Entry: 1jwm (more details), 2.7 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1(HA peptide 306-318) with the Superantigen SEC3
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1jwmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwmb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1jwmb2:

Click to download the PDB-style file with coordinates for d1jwmb2.
(The format of our PDB-style files is described here.)

Timeline for d1jwmb2: