Lineage for d1jtsk_ (1jts K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988893Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1988916Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 1988963Domain d1jtsk_: 1jts K: [84216]
    complexed with trs

Details for d1jtsk_

PDB Entry: 1jts (more details), 2.6 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (K:) DNA protection during starvation protein

SCOPe Domain Sequences for d1jtsk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtsk_ a.25.1.1 (K:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1jtsk_:

Click to download the PDB-style file with coordinates for d1jtsk_.
(The format of our PDB-style files is described here.)

Timeline for d1jtsk_: