Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1jtsh_ (1jts H:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Dodecameric ferritin homolog [47250] (14 species)
  7. Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. Domain d1jtsh_: 1jts H: [84213]
    complexed with trs

Details for d1jtsh_

PDB Entry: 1jts (more details)
PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (H:) DNA protection during starvation protein

SCOP Domain Sequences for d1jtsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtsh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1jtsh_:

Click to download the PDB-style file with coordinates for d1jtsh_.
(The format of our PDB-style files is described here.)

Timeline for d1jtsh_:

d1jtsh_ appears in SCOP 1.75A


d1jtsh_
(click for larger image)


d1jtsh_ in context of chain



d1jtsh_ in context of PDB
Domains from other chains:
d1jtsa_, d1jtsb_, d1jtsc_, d1jtsd_, d1jtse_, d1jtsf_, d1jtsg_, d1jtsi_, d1jtsj_, d1jtsk_, d1jtsl_, d1jtsm_, d1jtsn_, d1jtso_, d1jtsp_, d1jtsq_, d1jtsr_, d1jtss_, d1jtst_, d1jtsu_, d1jtsv_, d1jtsw_, d1jtsx_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu