Lineage for d1jtsg_ (1jts G:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279750Protein Dodecameric ferritin homolog [47250] (7 species)
  7. 279773Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 279816Domain d1jtsg_: 1jts G: [84212]

Details for d1jtsg_

PDB Entry: 1jts (more details), 2.6 Å

PDB Description: dna protection and binding by e. coli dps protein

SCOP Domain Sequences for d1jtsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtsg_ a.25.1.1 (G:) Dodecameric ferritin homolog {Escherichia coli, Dps}
nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
rkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1jtsg_:

Click to download the PDB-style file with coordinates for d1jtsg_.
(The format of our PDB-style files is described here.)

Timeline for d1jtsg_: