Lineage for d1jrla_ (1jrl A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311542Superfamily c.23.10: SGHN hydrolase [52266] (5 families) (S)
  5. 311572Family c.23.10.5: Thioesterase I, TAP [89594] (1 protein)
  6. 311573Protein Thioesterase I, TAP [89595] (1 species)
    multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities
  7. 311574Species Escherichia coli [TaxId:562] [89596] (3 PDB entries)
  8. 311575Domain d1jrla_: 1jrl A: [84205]
    complexed with imd, so4; mutant

Details for d1jrla_

PDB Entry: 1jrl (more details), 1.95 Å

PDB Description: crystal structure of e. coli lysophospholiase l1/acyl-coa thioesterase i/protease i l109p mutant

SCOP Domain Sequences for d1jrla_:

Sequence, based on SEQRES records: (download)

>d1jrla_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn

Sequence, based on observed residues (ATOM records): (download)

>d1jrla_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli}
adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrryneaf
saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn

SCOP Domain Coordinates for d1jrla_:

Click to download the PDB-style file with coordinates for d1jrla_.
(The format of our PDB-style files is described here.)

Timeline for d1jrla_: