Lineage for d1jrek_ (1jre K:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766282Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 766317Domain d1jrek_: 1jre K: [84203]

Details for d1jrek_

PDB Entry: 1jre (more details), 2.65 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (K:) DNA protection during starvation protein

SCOP Domain Sequences for d1jrek_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrek_ a.25.1.1 (K:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
rkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1jrek_:

Click to download the PDB-style file with coordinates for d1jrek_.
(The format of our PDB-style files is described here.)

Timeline for d1jrek_: