![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (14 species) |
![]() | Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
![]() | Domain d1jrec_: 1jre C: [84195] protein/DNA complex; complexed with cd, trs |
PDB Entry: 1jre (more details), 2.65 Å
SCOPe Domain Sequences for d1jrec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrec_ a.25.1.1 (C:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]} nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv rkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1jrec_: