Lineage for d1jova_ (1jov A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045078Family b.30.5.7: Hypothetical protein HI1317 [89279] (1 protein)
    automatically mapped to Pfam PF01263
  6. 2045079Protein Hypothetical protein HI1317 [89280] (1 species)
  7. 2045080Species Haemophilus influenzae [TaxId:727] [89281] (1 PDB entry)
  8. 2045081Domain d1jova_: 1jov A: [84192]
    structural genomics
    complexed with so4, trs

Details for d1jova_

PDB Entry: 1jov (more details), 1.57 Å

PDB Description: Crystal Structure Analysis of HI1317
PDB Compounds: (A:) hi1317

SCOPe Domain Sequences for d1jova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jova_ b.30.5.7 (A:) Hypothetical protein HI1317 {Haemophilus influenzae [TaxId: 727]}
mkttllktltpelhlvqhndipvlhlkhavgtakislqgaqliswkpqnakqdvlwlsev
epfkngnairggvpicypwfggvkqpahgtarirlwqlshyyisvhkvrlefelfsdlni
ieakvsmvftdkchltfthygeesaqaalhtyfnigdinqvevqglpetcfnslnqqqen
vpsprhisenvdciysaenmqnqildksfnrtialhhhnasqfvlwnpwhkktsgmsetg
yqkmlcletarihhllefgeslsveislk

SCOPe Domain Coordinates for d1jova_:

Click to download the PDB-style file with coordinates for d1jova_.
(The format of our PDB-style files is described here.)

Timeline for d1jova_: