SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jova_ (1jov A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045078Family b.30.5.7: Hypothetical protein HI1317 [89279] (1 protein)
    automatically mapped to Pfam PF01263
  6. 2045079Protein Hypothetical protein HI1317 [89280] (1 species)
  7. 2045080Species Haemophilus influenzae [TaxId:727] [89281] (1 PDB entry)
  8. 2045081Domain d1jova_: 1jov A: [84192]
    structural genomics
    complexed with so4, trs

Details for d1jova_

PDB Entry: 1jov (more details), 1.57 Å

PDB Description: Crystal Structure Analysis of HI1317
PDB Compounds: (A:) hi1317

SCOPe Domain Sequences for d1jova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jova_ b.30.5.7 (A:) Hypothetical protein HI1317 {Haemophilus influenzae [TaxId: 727]}
mkttllktltpelhlvqhndipvlhlkhavgtakislqgaqliswkpqnakqdvlwlsev
epfkngnairggvpicypwfggvkqpahgtarirlwqlshyyisvhkvrlefelfsdlni
ieakvsmvftdkchltfthygeesaqaalhtyfnigdinqvevqglpetcfnslnqqqen
vpsprhisenvdciysaenmqnqildksfnrtialhhhnasqfvlwnpwhkktsgmsetg
yqkmlcletarihhllefgeslsveislk

SCOPe Domain Coordinates for d1jova_:

Click to download the PDB-style file with coordinates for d1jova_.
(The format of our PDB-style files is described here.)

Timeline for d1jova_: