Lineage for d1jnta_ (1jnt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941545Protein Parvulin 10 (rotamase C) [89877] (1 species)
  7. 2941546Species Escherichia coli [TaxId:562] [89878] (2 PDB entries)
  8. 2941547Domain d1jnta_: 1jnt A: [84186]
    has additional insertions and/or extensions that are not grouped together

Details for d1jnta_

PDB Entry: 1jnt (more details)

PDB Description: nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d1jnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnta_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]}
aktaaalhilvkeeklaldlleqikngadfgklakkhsicpsgkrggdlgefrqgqmvpa
fdkvvfscpvleptgplhtqfgyhiikvlyrn

SCOPe Domain Coordinates for d1jnta_:

Click to download the PDB-style file with coordinates for d1jnta_.
(The format of our PDB-style files is described here.)

Timeline for d1jnta_: