SCOP 1.65: Domain d1jnqa2: 1jnq A:9-167

Lineage for d1jnqa2 (1jnq A:9-167)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (6 PDB entries)

8. Domain d1jnqa2: 1jnq A:9-167 [84184]
   Other proteins in same PDB: d1jnqa1
   complexed with egt, fe2

Details for d1jnqa2

PDB Entry: 1jnq, 2.1 Å

PDB Description: lipoxygenase-3 (soybean) complex with epigallocathechin (egc)

SCOP Domain Sequences for d1jnqa2:

Sequence; same for both SEQRES and ATOM records:

>d1jnqa2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty

Timeline for d1jnqa2:

• d1jnqa2 is new in SCOP 1.65
  
• d1jnqa2 appears in SCOP 1.67
  
• d1jnqa2 appears in the current release, SCOPe 2.08