Lineage for d1jhsa_ (1jhs A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968341Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 2968342Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) (S)
  5. 2968343Family d.107.1.1: Ran-binding protein mog1p [55725] (1 protein)
  6. 2968344Protein Ran-binding protein mog1p [55726] (1 species)
  7. 2968345Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55727] (2 PDB entries)
  8. 2968346Domain d1jhsa_: 1jhs A: [84172]
    mutant

Details for d1jhsa_

PDB Entry: 1jhs (more details), 1.9 Å

PDB Description: protein mog1 e65a mutant
PDB Compounds: (A:) mog1 protein

SCOPe Domain Sequences for d1jhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhsa_ d.107.1.1 (A:) Ran-binding protein mog1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnnkevelyggaittvvppgfidastlrevpdtqavyvnsrrdeeefedglatnesiivd
lletvdksdlkeawqfhvedltelngttkwealqedtvqqgtkftglvmevankwgkpdl
aqtvvigvalirltqfdtdvvisinvpltkeeasqasnkelparchavyqllqemvrkfh
vvdtslfa

SCOPe Domain Coordinates for d1jhsa_:

Click to download the PDB-style file with coordinates for d1jhsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jhsa_: