Class a: All alpha proteins [46456] (289 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) |
Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins) |
Protein poly(A) binding protein [63572] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [63573] (3 PDB entries) |
Domain d1jh4a1: 1jh4 A:6-98 [84171] Other proteins in same PDB: d1jh4a2 complexed with paip1 peptide, chain B protein/RNA complex |
PDB Entry: 1jh4 (more details)
SCOPe Domain Sequences for d1jh4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jh4a1 a.144.1.1 (A:6-98) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]} pltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespesl rskvdeavavlqahqakeaaqkavnsatgvptv
Timeline for d1jh4a1: