SCOPe 2.06: Domain d1jh4a1: 1jh4 A:6-98

Lineage for d1jh4a1 (1jh4 A:6-98)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)

6. Protein poly(A) binding protein [63572] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63573] (3 PDB entries)

8. Domain d1jh4a1: 1jh4 A:6-98 [84171]
   Other proteins in same PDB: d1jh4a2
   complexed with paip1 peptide, chain B
   protein/RNA complex

Details for d1jh4a1

PDB Entry: 1jh4

PDB Description: solution structure of the c-terminal pabc domain of human poly(a)- binding protein in complex with the peptide from paip1

PDB Compounds: (A:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d1jh4a1:

Sequence; same for both SEQRES and ATOM records:

>d1jh4a1 a.144.1.1 (A:6-98) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]}
pltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespesl
rskvdeavavlqahqakeaaqkavnsatgvptv

Timeline for d1jh4a1:

• d1jh4a1 first appeared in SCOP 1.65, called d1jh4a_
  
• d1jh4a1 was called d1jh4a_ in SCOPe 2.05
  
• d1jh4a1 appears in SCOPe 2.07
  
• d1jh4a1 appears in the current release, SCOPe 2.08