![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
![]() | Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (8 PDB entries) |
![]() | Domain d1jgda2: 1jgd A:1-181 [84168] Other proteins in same PDB: d1jgda1, d1jgdb_ complexed with gol |
PDB Entry: 1jgd (more details), 1.9 Å
SCOP Domain Sequences for d1jgda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgda2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]} gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq r
Timeline for d1jgda2: