Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
Domain d1jgda1: 1jgd A:182-276 [84167] Other proteins in same PDB: d1jgda2, d1jgdb_ complexed with gol |
PDB Entry: 1jgd (more details), 1.9 Å
SCOP Domain Sequences for d1jgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgda1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)} adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d1jgda1: