SCOP 1.73: Domain d1jcnb2: 1jcn B:112-164

Lineage for d1jcnb2 (1jcn B:112-164)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (10 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type I [TaxId:9606] [89899] (1 PDB entry)

8. Domain d1jcnb2: 1jcn B:112-164 [84164]
   Other proteins in same PDB: d1jcna1, d1jcnb1

Details for d1jcnb2

PDB Entry: 1jcn, 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp

PDB Compounds: (B:) inosine monophosphate dehydrogenase I

SCOP Domain Sequences for d1jcnb2:

Sequence, based on SEQRES records:

>d1jcnb2 d.37.1.1 (B:112-164) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I [TaxId: 9606]}
qgfitdpvvlspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdid

Sequence, based on observed residues (ATOM records):

>d1jcnb2 d.37.1.1 (B:112-164) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I [TaxId: 9606]}
qgfitdpvvlspgipitevgivtsrdid

Timeline for d1jcnb2:

• d1jcnb2 first appeared in SCOP 1.65
  
• d1jcnb2 appears in SCOP 1.71
  
• d1jcnb2 does not appear in SCOP 1.75