Lineage for d1jcnb2 (1jcn B:112-164)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410626Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410627Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 410628Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 410643Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 410647Species Human (Homo sapiens), type I [TaxId:9606] [89899] (1 PDB entry)
  8. 410650Domain d1jcnb2: 1jcn B:112-164 [84164]
    Other proteins in same PDB: d1jcna1, d1jcnb1

Details for d1jcnb2

PDB Entry: 1jcn (more details), 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp

SCOP Domain Sequences for d1jcnb2:

Sequence, based on SEQRES records: (download)

>d1jcnb2 d.37.1.1 (B:112-164) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I}
qgfitdpvvlspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdid

Sequence, based on observed residues (ATOM records): (download)

>d1jcnb2 d.37.1.1 (B:112-164) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I}
qgfitdpvvlspgipitevgivtsrdid

SCOP Domain Coordinates for d1jcnb2:

Click to download the PDB-style file with coordinates for d1jcnb2.
(The format of our PDB-style files is described here.)

Timeline for d1jcnb2: