![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.37: CBS-domain [54630] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.37.1: CBS-domain [54631] (1 family) ![]() |
![]() | Family d.37.1.1: CBS-domain [54632] (1 protein) |
![]() | Protein Type II inosine monophosphate dehydrogenase [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
![]() | Species Human (Homo sapiens), type I [TaxId:9606] [89899] (1 PDB entry) |
![]() | Domain d1jcnb2: 1jcn B:112-164 [84164] Other proteins in same PDB: d1jcna1, d1jcnb1 |
PDB Entry: 1jcn (more details), 2.5 Å
SCOP Domain Sequences for d1jcnb2:
Sequence, based on SEQRES records: (download)
>d1jcnb2 d.37.1.1 (B:112-164) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens), type I} qgfitdpvvlspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdid
>d1jcnb2 d.37.1.1 (B:112-164) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens), type I} qgfitdpvvlspgipitevgivtsrdid
Timeline for d1jcnb2: