Lineage for d1jcnb1 (1jcn B:10-111,B:232-499)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384178Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 384179Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 384180Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)
  7. 384184Species Human (Homo sapiens), type I [TaxId:9606] [89456] (1 PDB entry)
  8. 384186Domain d1jcnb1: 1jcn B:10-111,B:232-499 [84163]
    Other proteins in same PDB: d1jcna2, d1jcna3, d1jcnb2, d1jcnb3
    contains two CBS domains inserted into the common fold, residues 111-231
    complexed with cpr

Details for d1jcnb1

PDB Entry: 1jcn (more details), 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp

SCOP Domain Sequences for d1jcnb1:

Sequence, based on SEQRES records: (download)

>d1jcnb1 c.1.5.1 (B:10-111,B:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type I}
tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeXdyplaskdsqkqllcga
avgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqviggnvvtaa
qaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvpiiadggiq
tvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldamekssssqk
ryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlrsmmysgel
kfekrtmsaqi

Sequence, based on observed residues (ATOM records): (download)

>d1jcnb1 c.1.5.1 (B:10-111,B:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type I}
tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeXdyplaskdsqkqllcga
avgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqviggnvvtaa
qaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvpiiadggiq
tvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagiqhgcqdigarslsv
lrsmmysgelkfekrtmsaqi

SCOP Domain Coordinates for d1jcnb1:

Click to download the PDB-style file with coordinates for d1jcnb1.
(The format of our PDB-style files is described here.)

Timeline for d1jcnb1: