SCOP 1.65: Domain d1jcna2: 1jcn A:112-164

Lineage for d1jcna2 (1jcn A:112-164)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (1 protein)

6. Protein Type II inosine monophosphate dehydrogenase [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type I [TaxId:9606] [89899] (1 PDB entry)

8. Domain d1jcna2: 1jcn A:112-164 [84161]
   Other proteins in same PDB: d1jcna1, d1jcnb1

Details for d1jcna2

PDB Entry: 1jcn, 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp

SCOP Domain Sequences for d1jcna2:

Sequence, based on SEQRES records:

>d1jcna2 d.37.1.1 (A:112-164) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens), type I}
qgfitdpvvlspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdid

Sequence, based on observed residues (ATOM records):

>d1jcna2 d.37.1.1 (A:112-164) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens), type I}
qgfitdpvvlspgipitevgivtsrdid

Timeline for d1jcna2:

• d1jcna2 is new in SCOP 1.65
  
• d1jcna2 appears in SCOP 1.67
  
• d1jcna2 last appears in SCOP 1.73