Lineage for d1jcna1 (1jcn A:10-111,A:232-499)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570835Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 570836Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 570837Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)
  7. 570841Species Human (Homo sapiens), type I [TaxId:9606] [89456] (1 PDB entry)
  8. 570842Domain d1jcna1: 1jcn A:10-111,A:232-499 [84160]
    Other proteins in same PDB: d1jcna2, d1jcna3, d1jcnb2, d1jcnb3

Details for d1jcna1

PDB Entry: 1jcn (more details), 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp

SCOP Domain Sequences for d1jcna1:

Sequence, based on SEQRES records: (download)

>d1jcna1 c.1.5.1 (A:10-111,A:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type I}
tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeXdyplaskdsqkqllcga
avgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqviggnvvtaa
qaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvpiiadggiq
tvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldamekssssqk
ryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlrsmmysgel
kfekrtmsaqi

Sequence, based on observed residues (ATOM records): (download)

>d1jcna1 c.1.5.1 (A:10-111,A:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type I}
tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeXdyplaskdsqkqllcga
avgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqviggnvvtaa
qaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvpiiadggiq
tvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagiqhgcqdigarslsv
lrsmmysgelkfekrtmsaqi

SCOP Domain Coordinates for d1jcna1:

Click to download the PDB-style file with coordinates for d1jcna1.
(The format of our PDB-style files is described here.)

Timeline for d1jcna1: