Lineage for d1jcna1 (1jcn A:10-111,A:232-499)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080662Species Human (Homo sapiens), type I [TaxId:9606] [89456] (1 PDB entry)
  8. 2080663Domain d1jcna1: 1jcn A:10-111,A:232-499 [84160]
    Other proteins in same PDB: d1jcna4, d1jcnb4
    contains two CBS domains inserted into the common fold, residues 111-231
    complexed with cpr

Details for d1jcna1

PDB Entry: 1jcn (more details), 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp
PDB Compounds: (A:) inosine monophosphate dehydrogenase I

SCOPe Domain Sequences for d1jcna1:

Sequence, based on SEQRES records: (download)

>d1jcna1 c.1.5.1 (A:10-111,A:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type I [TaxId: 9606]}
tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeXdyplaskdsqkqllcga
avgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqviggnvvtaa
qaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvpiiadggiq
tvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldamekssssqk
ryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlrsmmysgel
kfekrtmsaqi

Sequence, based on observed residues (ATOM records): (download)

>d1jcna1 c.1.5.1 (A:10-111,A:232-499) Inosine monophosphate dehydrogenase (IMPDH) {Human (Homo sapiens), type I [TaxId: 9606]}
tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeXdyplaskdsqkqllcga
avgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqviggnvvtaa
qaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvpiiadggiq
tvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagiqhgcqdigarslsv
lrsmmysgelkfekrtmsaqi

SCOPe Domain Coordinates for d1jcna1:

Click to download the PDB-style file with coordinates for d1jcna1.
(The format of our PDB-style files is described here.)

Timeline for d1jcna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcna4