SCOPe 2.05: Domain d1jbob_: 1jbo B:

Lineage for d1jbob_ (1jbo B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (8 species)

7. Species Synechococcus elongatus [TaxId:32046] [88968] (1 PDB entry)

8. Domain d1jbob_: 1jbo B: [84151]
   Other proteins in same PDB: d1jboa_
   complexed with cyc

Details for d1jbob_

PDB Entry: 1jbo, 1.45 Å

PDB Description: The 1.45A Three-Dimensional Structure of c-Phycocyanin from the Thermophylic Cyanobacterium Synechococcus elongatus

PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d1jbob_:

Sequence; same for both SEQRES and ATOM records:

>d1jbob_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus elongatus [TaxId: 32046]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d1jbob_:

• d1jbob_ first appeared in SCOP 1.65
  
• d1jbob_ appears in SCOPe 2.04
  
• d1jbob_ appears in SCOPe 2.06
  
• d1jbob_ appears in the current release, SCOPe 2.08