SCOP 1.65: Domain d1jboa_: 1jbo A:

Lineage for d1jboa_ (1jbo A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin alpha subunit [88933] (6 species)

7. Species Synechococcus elongatus [TaxId:32046] [88967] (1 PDB entry)

8. Domain d1jboa_: 1jbo A: [84150]
   Other proteins in same PDB: d1jbob_
   complexed with cyc, men

Details for d1jboa_

PDB Entry: 1jbo, 1.45 Å

PDB Description: The 1.45A Three-Dimensional Structure of c-Phycocyanin from the Thermophylic Cyanobacterium Synechococcus elongatus

SCOP Domain Sequences for d1jboa_:

Sequence; same for both SEQRES and ATOM records:

>d1jboa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus elongatus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d1jboa_:

• d1jboa_ is new in SCOP 1.65
  
• d1jboa_ appears in SCOP 1.67
  
• d1jboa_ appears in the current release, SCOPe 2.08