SCOPe 2.08: Domain d1jboa_: 1jbo A:

Lineage for d1jboa_ (1jbo A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (10 species)

7. Species Synechococcus elongatus [TaxId:32046] [88967] (1 PDB entry)

8. Domain d1jboa_: 1jbo A: [84150]
   Other proteins in same PDB: d1jbob_
   complexed with cyc

Details for d1jboa_

PDB Entry: 1jbo, 1.45 Å

PDB Description: The 1.45A Three-Dimensional Structure of c-Phycocyanin from the Thermophylic Cyanobacterium Synechococcus elongatus

PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d1jboa_:

Sequence; same for both SEQRES and ATOM records:

>d1jboa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus elongatus [TaxId: 32046]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d1jboa_:

• d1jboa_ first appeared in SCOP 1.65
  
• d1jboa_ appears in SCOPe 2.07