![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein YchF GTP-binding protein N-terminal domain [82410] (2 species) Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomain |
![]() | Species Haemophilus influenzae [TaxId:727] [89666] (1 PDB entry) HI0393 |
![]() | Domain d1jalb1: 1jal B:1-278 [84140] Other proteins in same PDB: d1jala2, d1jalb2 structural genomics |
PDB Entry: 1jal (more details), 2.4 Å
SCOPe Domain Sequences for d1jalb1:
Sequence, based on SEQRES records: (download)
>d1jalb1 c.37.1.8 (B:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} mgfkcgivglpnvgkstlfnaltkagieaanypfctiepntgvvpmpdprldalaeivkp erilpttmefvdiaglvagaskgeglgnkflaniretdaighvvrcfenddivhvagkid plddidtintelaladldsceraiqrlqkrakggdkeakfelsvmekilpvlenagmirs vgldkeelqaiksynfltlkptmyianvnedgfennpyldrvreiaakegavvvpvcaai eseiaelddeekveflqdlgieepglnrviragyalln
>d1jalb1 c.37.1.8 (B:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} mgfkcgivglpnvgkstlfnaltkatgvvpmpdprldalaeivkperilpttmefvdiag lvagaskgeglgnkflaniretdaighvvrcfelddidtintelaladldsceraiqrlq krakggdkeakfelsvmekilpvlenagmirsvgldkeelqaiksynfltlkptmyianv nedgfennpyldrvreiaakegavvvpvcaaieseiaelddeekveflqdlgieepglnr viragyalln
Timeline for d1jalb1: