Lineage for d1jalb1 (1jal B:1-278)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111122Protein YchF GTP-binding protein N-terminal domain [82410] (2 species)
    Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomain
  7. 2111125Species Haemophilus influenzae [TaxId:727] [89666] (1 PDB entry)
    HI0393
  8. 2111127Domain d1jalb1: 1jal B:1-278 [84140]
    Other proteins in same PDB: d1jala2, d1jalb2
    structural genomics

Details for d1jalb1

PDB Entry: 1jal (more details), 2.4 Å

PDB Description: ychf protein (hi0393)
PDB Compounds: (B:) YchF protein

SCOPe Domain Sequences for d1jalb1:

Sequence, based on SEQRES records: (download)

>d1jalb1 c.37.1.8 (B:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}
mgfkcgivglpnvgkstlfnaltkagieaanypfctiepntgvvpmpdprldalaeivkp
erilpttmefvdiaglvagaskgeglgnkflaniretdaighvvrcfenddivhvagkid
plddidtintelaladldsceraiqrlqkrakggdkeakfelsvmekilpvlenagmirs
vgldkeelqaiksynfltlkptmyianvnedgfennpyldrvreiaakegavvvpvcaai
eseiaelddeekveflqdlgieepglnrviragyalln

Sequence, based on observed residues (ATOM records): (download)

>d1jalb1 c.37.1.8 (B:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}
mgfkcgivglpnvgkstlfnaltkatgvvpmpdprldalaeivkperilpttmefvdiag
lvagaskgeglgnkflaniretdaighvvrcfelddidtintelaladldsceraiqrlq
krakggdkeakfelsvmekilpvlenagmirsvgldkeelqaiksynfltlkptmyianv
nedgfennpyldrvreiaakegavvvpvcaaieseiaelddeekveflqdlgieepglnr
viragyalln

SCOPe Domain Coordinates for d1jalb1:

Click to download the PDB-style file with coordinates for d1jalb1.
(The format of our PDB-style files is described here.)

Timeline for d1jalb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jalb2