Lineage for d1jala2 (1jal A:279-363)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2542179Superfamily d.15.10: TGS-like [81271] (3 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 2542193Family d.15.10.2: G domain-linked domain [82583] (2 proteins)
  6. 2542197Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species)
    N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain
  7. 2542200Species Haemophilus influenzae [TaxId:727] [89836] (1 PDB entry)
    HI0393
  8. 2542201Domain d1jala2: 1jal A:279-363 [84139]
    Other proteins in same PDB: d1jala1, d1jalb1
    structural genomics

Details for d1jala2

PDB Entry: 1jal (more details), 2.4 Å

PDB Description: ychf protein (hi0393)
PDB Compounds: (A:) YchF protein

SCOPe Domain Sequences for d1jala2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]}
lqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengake
agkwrlegkdyivqdgdvmhfrfnv

SCOPe Domain Coordinates for d1jala2:

Click to download the PDB-style file with coordinates for d1jala2.
(The format of our PDB-style files is described here.)

Timeline for d1jala2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jala1