Lineage for d1jala2 (1jal A:279-363)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718256Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 718270Family d.15.10.2: G domain-linked domain [82583] (2 proteins)
  6. 718274Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species)
    N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain
  7. 718277Species Haemophilus influenzae [TaxId:727] [89836] (1 PDB entry)
    HI0393
  8. 718278Domain d1jala2: 1jal A:279-363 [84139]
    Other proteins in same PDB: d1jala1, d1jalb1

Details for d1jala2

PDB Entry: 1jal (more details), 2.4 Å

PDB Description: ychf protein (hi0393)
PDB Compounds: (A:) YchF protein

SCOP Domain Sequences for d1jala2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]}
lqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengake
agkwrlegkdyivqdgdvmhfrfnv

SCOP Domain Coordinates for d1jala2:

Click to download the PDB-style file with coordinates for d1jala2.
(The format of our PDB-style files is described here.)

Timeline for d1jala2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jala1