Lineage for d1j9aa_ (1j9a A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374591Protein Oligoribonuclease [89719] (2 species)
  7. 1374599Species Haemophilus influenzae [TaxId:727] [89720] (1 PDB entry)
    HI1715
  8. 1374600Domain d1j9aa_: 1j9a A: [84135]
    CASP4
    structural genomics
    complexed with so4

Details for d1j9aa_

PDB Entry: 1j9a (more details), 2.5 Å

PDB Description: oligoribonuclease
PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d1j9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9aa_ c.55.3.5 (A:) Oligoribonuclease {Haemophilus influenzae [TaxId: 727]}
shmsfdkqnliwidlemtgldpekeriieiativtdknlnilaegpvlavhqsdellnkm
ndwcqkthsenglierikasklteraaelqtldflkkwvpkgaspicgnsiaqdkrflvk
ympdladyfhyrhldvstlkelaarwkpeilegfkkenthlalddiresikelayyrehf
mkld

SCOPe Domain Coordinates for d1j9aa_:

Click to download the PDB-style file with coordinates for d1j9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1j9aa_: