SCOP 1.65: Domain d1j7jb_: 1j7j B:

Lineage for d1j7jb_ (1j7j B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)

6. Protein Hypoxanthine PRTase [53286] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [89728] (1 PDB entry)

8. Domain d1j7jb_: 1j7j B: [84132]
   complexed with mg

Details for d1j7jb_

PDB Entry: 1j7j, 2.3 Å

PDB Description: Crystal Structure of the HPRT from Salmonella typhimurium

SCOP Domain Sequences for d1j7jb_:

Sequence, based on SEQRES records:

>d1j7jb_ c.61.1.1 (B:) Hypoxanthine PRTase {Salmonella typhimurium}
htvevmipeaeikariaelgrqiterykdsgsemvlvgllrgsfmfmadlcrevqvphev
dfmtassygsgmsttrdvkilkdldedirgkdvlivediidsgntlskvreilglrepks
laictlldkpsrrevdvpvefvgfsipdefvvgygidyaqryrhlpyvgkvvl

Sequence, based on observed residues (ATOM records):

>d1j7jb_ c.61.1.1 (B:) Hypoxanthine PRTase {Salmonella typhimurium}
htvevmipeaeikariaelgrqiterykdsgsemvlvgllrgsfmfmadlcrevqvphev
dfmtasrdvkilkdldedirgkdvlivediidsgntlskvreilglrepkslaictlldk
psrrevdvpvefvgfsipdefvvgygidyaqryrhlpyvgkvvl

Timeline for d1j7jb_:

• d1j7jb_ is new in SCOP 1.65
  
• d1j7jb_ appears in SCOP 1.67
  
• d1j7jb_ appears in the current release, SCOPe 2.08