Lineage for d1j7ja_ (1j7j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128315Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2128323Species Salmonella typhimurium [TaxId:90371] [89728] (1 PDB entry)
  8. 2128324Domain d1j7ja_: 1j7j A: [84131]
    complexed with mg

Details for d1j7ja_

PDB Entry: 1j7j (more details), 2.3 Å

PDB Description: Crystal Structure of the HPRT from Salmonella typhimurium
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1j7ja_:

Sequence, based on SEQRES records: (download)

>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]}
htvevmipeaeikariaelgrqiterykdsgsemvlvgllrgsfmfmadlcrevqvphev
dfmtassygsgmsttrdvkilkdldedirgkdvlivediidsgntlskvreilglrepks
laictlldkpsrrevdvpvefvgfsipdefvvgygidyaqryrhlpyvgkvv

Sequence, based on observed residues (ATOM records): (download)

>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]}
htvevmipeaeikariaelgrqiterykdsgsemvlvgllrgsfmfmadlcrevqvphev
dfmtasrdvkilkdldedirgkdvlivediidsgntlskvreilglrepkslaictlldk
psrrevdvpvefvgfsipdefvvgygidyaqryrhlpyvgkvv

SCOPe Domain Coordinates for d1j7ja_:

Click to download the PDB-style file with coordinates for d1j7ja_.
(The format of our PDB-style files is described here.)

Timeline for d1j7ja_: