SCOP 1.73: Domain d1j72a1: 1j72 A:11-124

Lineage for d1j72a1 (1j72 A:11-124)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.109: Gelsolin-like [55752] (2 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Macrophage capping protein Cap G [75511] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)

8. Domain d1j72a1: 1j72 A:11-124 [84127]

Details for d1j72a1

PDB Entry: 1j72, 2.5 Å

PDB Description: Crystal Structure of Mutant Macrophage Capping Protein (Cap G) with Actin-severing Activity in the Ca2+-Free Form

PDB Compounds: (A:) Macrophage capping protein

SCOP Domain Sequences for d1j72a1:

Sequence; same for both SEQRES and ATOM records:

>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]}
pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss
rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesg

Timeline for d1j72a1:

• d1j72a1 first appeared in SCOP 1.65
  
• d1j72a1 appears in SCOP 1.71
  
• d1j72a1 appears in SCOP 1.75
  
• d1j72a1 appears in the current release, SCOPe 2.08