Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.109: Gelsolin-like [55752] (2 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (4 proteins) |
Protein Macrophage capping protein Cap G [75511] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries) |
Domain d1j72a1: 1j72 A:11-124 [84127] |
PDB Entry: 1j72 (more details), 2.5 Å
SCOP Domain Sequences for d1j72a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens)} pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesg
Timeline for d1j72a1: