Lineage for d1j72a1 (1j72 A:11-124)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417014Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 417015Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 417016Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 417062Protein Macrophage capping protein Cap G [75511] (1 species)
  7. 417063Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)
  8. 417064Domain d1j72a1: 1j72 A:11-124 [84127]

Details for d1j72a1

PDB Entry: 1j72 (more details), 2.5 Å

PDB Description: Crystal Structure of Mutant Macrophage Capping Protein (Cap G) with Actin-severing Activity in the Ca2+-Free Form

SCOP Domain Sequences for d1j72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens)}
pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss
rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesg

SCOP Domain Coordinates for d1j72a1:

Click to download the PDB-style file with coordinates for d1j72a1.
(The format of our PDB-style files is described here.)

Timeline for d1j72a1: