Lineage for d1j70c2 (1j70 C:169-389)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105986Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 protein domains)
    automatically mapped to Pfam PF01747
  6. 2105987Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2105988Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (8 PDB entries)
  8. 2105992Domain d1j70c2: 1j70 C:169-389 [84125]
    Other proteins in same PDB: d1j70a1, d1j70a3, d1j70a4, d1j70b1, d1j70b3, d1j70b4, d1j70c1, d1j70c3
    complexed with na, po4

Details for d1j70c2

PDB Entry: 1j70 (more details), 2.3 Å

PDB Description: crystal structure of yeast atp sulfurylase
PDB Compounds: (C:) ATP sulphurylase

SCOPe Domain Sequences for d1j70c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j70c2 c.26.1.5 (C:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOPe Domain Coordinates for d1j70c2:

Click to download the PDB-style file with coordinates for d1j70c2.
(The format of our PDB-style files is described here.)

Timeline for d1j70c2: