Lineage for d1j70b2 (1j70 B:169-389)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482667Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 482668Protein ATP sulfurylase central domain [63980] (4 species)
  7. 482669Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (8 PDB entries)
  8. 482672Domain d1j70b2: 1j70 B:169-389 [84122]
    Other proteins in same PDB: d1j70a1, d1j70a3, d1j70b1, d1j70b3, d1j70c1, d1j70c3

Details for d1j70b2

PDB Entry: 1j70 (more details), 2.3 Å

PDB Description: crystal structure of yeast atp sulfurylase

SCOP Domain Sequences for d1j70b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j70b2 c.26.1.5 (B:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOP Domain Coordinates for d1j70b2:

Click to download the PDB-style file with coordinates for d1j70b2.
(The format of our PDB-style files is described here.)

Timeline for d1j70b2: